PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00017018001
Common NameGSBRNA2T00017018001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family Dof
Protein Properties Length: 403aa    MW: 42493.7 Da    PI: 9.3387
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00017018001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof120.84.7e-3889148362
               zf-Dof   3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                          e+alkcprCdstntkfCy+nnysl+qPr+fCkaCrryWt+GGalr vPvGgg+r+nk+++
  GSBRNA2T00017018001  89 ETALKCPRCDSTNTKFCYFNNYSLTQPRHFCKACRRYWTRGGALRSVPVGGGCRRNKRTK 148
                          6789*****************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074788.0E-3972146IPR003851Zinc finger, Dof-type
PfamPF027014.1E-3291146IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.39492146IPR003851Zinc finger, Dof-type
PROSITE patternPS01361094130IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 403 aa     Download sequence    Send to blast
MVFSSFPTYP DSSNWQQHQP ITSTVGFTGD NNISQQFLPH HPLPSQPQQT PPPLHHNGGG  60
GGGPGGPGGS IRPGSMAERA RIANIPMPET ALKCPRCDST NTKFCYFNNY SLTQPRHFCK  120
ACRRYWTRGG ALRSVPVGGG CRRNKRTKNS SGGGGGGSSS SGNSKSQDSN TSSDQYHHRA  180
MANNQMGPPP SSTSLSSLLS SYNAGLIPGQ DHNNHVLGLG SSLPPLKLMP PLDFTDNFTL  240
QYGTVSAPSY HVGGGSGGGA AALLTGFDQW RFPAPHHQLP LLGGLDSSSS SSGLYQFDHQ  300
NQTGMDPGYG LVTGSGQYRP KNIFHNLASS SVSSAMVTAT ASQSASVKME DSNNQVNMSR  360
QLFGNEQQLW NIHGTAASTA AATTSSWSDV SNNFRSSSTS NI*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bna.145381e-146seed
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2410230.0AC241023.1 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB039N20, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009130703.10.0PREDICTED: dof zinc finger protein DOF5.1-like
RefseqXP_013725196.10.0PREDICTED: dof zinc finger protein DOF5.1-like
SwissprotQ9LZ561e-157DOF51_ARATH; Dof zinc finger protein DOF5.1
TrEMBLA0A078J0Z80.0A0A078J0Z8_BRANA; BnaA03g54830D protein
STRINGBra005725.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM115191732
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G02460.11e-121Dof family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]